Recombinant Full Length Human SMPD1 Protein, C-Flag-tagged
Cat.No. : | SMPD1-732HFL |
Product Overview : | Recombinant Full Length Human SMPD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65 kDa |
AA Sequence : | MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHP ARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLF EDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGD IPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKA WEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTY IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVY RMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPDGSLPEAQSLWPRPLF CTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Lysosome, Metabolic pathways, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | SMPD1 sphingomyelin phosphodiesterase 1 [ Homo sapiens (human) ] |
Official Symbol | SMPD1 |
Synonyms | ASM; NPD; ASMASE |
Gene ID | 6609 |
mRNA Refseq | NM_000543.5 |
Protein Refseq | NP_000534.3 |
MIM | 607608 |
UniProt ID | P17405 |
◆ Recombinant Proteins | ||
SMPD1-7354H | Recombinant Human SMPD1 protein, His-tagged | +Inquiry |
SMPD1-611H | Active Recombinant Human SMPD1 protein, His-tagged | +Inquiry |
SMPD1-2065H | Recombinant Human SMPD1 Protein, MYC/DDK-tagged | +Inquiry |
Smpd1-5976M | Recombinant Mouse Smpd1 Protein, Myc/DDK-tagged | +Inquiry |
SMPD1-3678H | Recombinant Human SMPD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMPD1-486MCL | Recombinant Mouse SMPD1 cell lysate | +Inquiry |
SMPD1-702HCL | Recombinant Human SMPD1 cell lysate | +Inquiry |
SMPD1-716HCL | Recombinant Human SMPD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMPD1 Products
Required fields are marked with *
My Review for All SMPD1 Products
Required fields are marked with *
0
Inquiry Basket