Recombinant Human SMPD1

Cat.No. : SMPD1-26292TH
Product Overview : Recombinant fragment of Human Acid sphingomyelinase with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPDGSLPEAQSLWPRPLF
Sequence Similarities : Belongs to the acid sphingomyelinase family.Contains 1 saposin B-type domain.
Gene Name SMPD1 sphingomyelin phosphodiesterase 1, acid lysosomal [ Homo sapiens ]
Official Symbol SMPD1
Synonyms SMPD1; sphingomyelin phosphodiesterase 1, acid lysosomal; sphingomyelin phosphodiesterase; acid sphingomyelinase; ASM;
Gene ID 6609
mRNA Refseq NM_000543
Protein Refseq NP_000534
MIM 607608
Uniprot ID P17405
Chromosome Location 11p15.4-p15.1
Pathway Ceramide signaling pathway, organism-specific biosystem; FAS (CD95) signaling pathway, organism-specific biosystem; IL2 signaling events mediated by PI3K, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function hydrolase activity, acting on glycosyl bonds; sphingomyelin phosphodiesterase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMPD1 Products

Required fields are marked with *

My Review for All SMPD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon