Recombinant Human SMPD1
Cat.No. : | SMPD1-26292TH |
Product Overview : | Recombinant fragment of Human Acid sphingomyelinase with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPDGSLPEAQSLWPRPLF |
Sequence Similarities : | Belongs to the acid sphingomyelinase family.Contains 1 saposin B-type domain. |
Gene Name | SMPD1 sphingomyelin phosphodiesterase 1, acid lysosomal [ Homo sapiens ] |
Official Symbol | SMPD1 |
Synonyms | SMPD1; sphingomyelin phosphodiesterase 1, acid lysosomal; sphingomyelin phosphodiesterase; acid sphingomyelinase; ASM; |
Gene ID | 6609 |
mRNA Refseq | NM_000543 |
Protein Refseq | NP_000534 |
MIM | 607608 |
Uniprot ID | P17405 |
Chromosome Location | 11p15.4-p15.1 |
Pathway | Ceramide signaling pathway, organism-specific biosystem; FAS (CD95) signaling pathway, organism-specific biosystem; IL2 signaling events mediated by PI3K, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; |
Function | hydrolase activity, acting on glycosyl bonds; sphingomyelin phosphodiesterase activity; |
◆ Recombinant Proteins | ||
SMPD1-5332H | Recombinant Human SMPD1 protein, His-SUMO-tagged | +Inquiry |
SMPD1-2047H | Recombinant Human SMPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMPD1-7353H | Recombinant Human SMPD1 protein, His-tagged | +Inquiry |
SMPD1-1263M | Recombinant Mouse SMPD1 protein, His-tagged | +Inquiry |
SMPD1-6318H | Recombinant Human SMPD1 Protein (Gly319-Gly579), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMPD1-702HCL | Recombinant Human SMPD1 cell lysate | +Inquiry |
SMPD1-716HCL | Recombinant Human SMPD1 cell lysate | +Inquiry |
SMPD1-486MCL | Recombinant Mouse SMPD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMPD1 Products
Required fields are marked with *
My Review for All SMPD1 Products
Required fields are marked with *
0
Inquiry Basket