Recombinant Full Length Human SOCS1 Protein, C-Flag-tagged
Cat.No. : | SOCS1-568HFL |
Product Overview : | Recombinant Full Length Human SOCS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including IL2, IL3 erythropoietin (EPO), CSF2/GM-CSF, and interferon (IFN)-gamma. The protein encoded by this gene functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of this gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA SALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGS RESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQ ITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway |
Protein Pathways : | Insulin signaling pathway, Jak-STAT signaling pathway, Type II diabetes mellitus, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | SOCS1 suppressor of cytokine signaling 1 [ Homo sapiens (human) ] |
Official Symbol | SOCS1 |
Synonyms | JAB; CIS1; SSI1; TIP3; CISH1; SSI-1; TIP-3; AISIMD; SOCS-1 |
Gene ID | 8651 |
mRNA Refseq | NM_003745.2 |
Protein Refseq | NP_003736.1 |
MIM | 603597 |
UniProt ID | O15524 |
◆ Recombinant Proteins | ||
SOCS1-2870H | Recombinant Human SOCS1 protein(1-211aa), His-tagged | +Inquiry |
SOCS1-568HFL | Recombinant Full Length Human SOCS1 Protein, C-Flag-tagged | +Inquiry |
SOCS1-895H | Recombinant Human SOCS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SOCS1-2387M | Recombinant Mouse SOCS1 Protein (1-212 aa), His-Myc-tagged | +Inquiry |
SOCS1-1525H | Recombinant Human SOCS1 Protein (1-211 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS1-1582HCL | Recombinant Human SOCS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOCS1 Products
Required fields are marked with *
My Review for All SOCS1 Products
Required fields are marked with *
0
Inquiry Basket