Recombinant Full Length Human SSX1 Protein
Cat.No. : | SSX1-499HF |
Product Overview : | Recombinant full length Human SSX1 with N terminal proprietary tag; predicted MWt 46.5 kDa inclusive of tag; Q16384, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 188 amino acids |
Description : | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. |
Form : | Liquid |
Molecular Mass : | 46.750kDa inclusive of tags |
AA Sequence : | MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKM KYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQ GNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRG KHAWTHRLRERKQLVIYEEISDPEEDDE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SSX1 synovial sarcoma, X breakpoint 1 [ Homo sapiens ] |
Official Symbol | SSX1 |
Synonyms | SSX1; synovial sarcoma, X breakpoint 1; protein SSX1; cancer/testis antigen family 5; member 1; CT5.1 |
Gene ID | 6756 |
mRNA Refseq | NM_005635 |
Protein Refseq | NP_005626 |
MIM | 312820 |
UniProt ID | Q16384 |
◆ Recombinant Proteins | ||
SSX1-755H | Recombinant Human SSX1 protein, His-SUMO-tagged | +Inquiry |
SSX1-31171TH | Recombinant Human SSX1 | +Inquiry |
SSX1-7541H | Recombinant Human SSX1, His-tagged | +Inquiry |
SSX1-2108H | Recombinant Human SSX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSX1-499HF | Recombinant Full Length Human SSX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX1-1450HCL | Recombinant Human SSX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSX1 Products
Required fields are marked with *
My Review for All SSX1 Products
Required fields are marked with *
0
Inquiry Basket