Recombinant Full Length Human SVBP Protein, GST-tagged

• Cat.No.: SVBP-2849HF
• Product Overview: Human SVBP full-length ORF (AAH29427.1, 1 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 66 amino acids
• Description: SVBP (Small Vasohibin Binding Protein) is a Protein Coding gene.
• Molecular Mass: 33.66 kDa
• AA Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SVBP small vasohibin binding protein [ Homo sapiens (human) ]
• Official Symbol: SVBP
• Synonyms: SVBP; small vasohibin binding protein; CCDC23; Small Vasohibin Binding Protein; Coiled-Coil Domain Containing 23; Coiled-Coil Domain-Containing Protein 23; Coiled Coil Domain-Containing Protein 23; Small Vasohibin-Binding Protein
• Gene ID: 374969
• mRNA Refseq: NM_199342
• Protein Refseq: NP_955374
• MIM: 617853
• UniProt ID: Q8N300