Recombinant Full Length Human SVBP Protein, GST-tagged

Cat.No. : SVBP-2849HF
Product Overview : Human SVBP full-length ORF (AAH29427.1, 1 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 66 amino acids
Description : SVBP (Small Vasohibin Binding Protein) is a Protein Coding gene.
Molecular Mass : 33.66 kDa
AA Sequence : MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SVBP small vasohibin binding protein [ Homo sapiens (human) ]
Official Symbol SVBP
Synonyms SVBP; small vasohibin binding protein; CCDC23; Small Vasohibin Binding Protein; Coiled-Coil Domain Containing 23; Coiled-Coil Domain-Containing Protein 23; Coiled Coil Domain-Containing Protein 23; Small Vasohibin-Binding Protein
Gene ID 374969
mRNA Refseq NM_199342
Protein Refseq NP_955374
MIM 617853
UniProt ID Q8N300

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SVBP Products

Required fields are marked with *

My Review for All SVBP Products

Required fields are marked with *

0
cart-icon