Recombinant Human SVBP Protein, GST-Tagged
Cat.No. : | SVBP-0538H |
Product Overview : | Human SVBP full-length ORF (AAH29427.1, 1 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SVBP (Small Vasohibin Binding Protein) is a Protein Coding gene. |
Molecular Mass : | 33.66 kDa |
AA Sequence : | MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SVBP small vasohibin binding protein [ Homo sapiens (human) ] |
Official Symbol | SVBP |
Synonyms | SVBP; small vasohibin binding protein; CCDC23; Small Vasohibin Binding Protein; Coiled-Coil Domain Containing 23; Coiled-Coil Domain-Containing Protein 23; Coiled Coil Domain-Containing Protein 23; Small Vasohibin-Binding Protein |
Gene ID | 374969 |
mRNA Refseq | NM_199342 |
Protein Refseq | NP_955374 |
UniProt ID | Q8N300 |
◆ Recombinant Proteins | ||
SVBP-3076H | Recombinant Human SVBP Protein, MYC/DDK-tagged | +Inquiry |
SVBP-2849HF | Recombinant Full Length Human SVBP Protein, GST-tagged | +Inquiry |
Svbp-6235M | Recombinant Mouse Svbp Protein, Myc/DDK-tagged | +Inquiry |
SVBP-2814H | Recombinant Human SVBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SVBP-0538H | Recombinant Human SVBP Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SVBP Products
Required fields are marked with *
My Review for All SVBP Products
Required fields are marked with *
0
Inquiry Basket