Recombinant Human SVBP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SVBP-2814H
Product Overview : CCDC23 MS Standard C13 and N15-labeled recombinant protein (NP_955374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin. This activity is critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning. Also required to enhance the solubility and secretion of VASH1 and VASH2. Plays a role in axon and excitatory synapse formation.
Molecular Mass : 7.6 kDa
AA Sequence : MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SVBP small vasohibin binding protein [ Homo sapiens (human) ]
Official Symbol SVBP
Synonyms SVBP; small vasohibin binding protein; CCDC23; NEDAHM; small vasohibin-binding protein; coiled-coil domain containing 23; coiled-coil domain-containing protein 23
Gene ID 374969
mRNA Refseq NM_199342
Protein Refseq NP_955374
MIM 617853
UniProt ID Q8N300

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SVBP Products

Required fields are marked with *

My Review for All SVBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon