Recombinant Human SVBP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SVBP-2814H |
Product Overview : | CCDC23 MS Standard C13 and N15-labeled recombinant protein (NP_955374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin. This activity is critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning. Also required to enhance the solubility and secretion of VASH1 and VASH2. Plays a role in axon and excitatory synapse formation. |
Molecular Mass : | 7.6 kDa |
AA Sequence : | MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SVBP small vasohibin binding protein [ Homo sapiens (human) ] |
Official Symbol | SVBP |
Synonyms | SVBP; small vasohibin binding protein; CCDC23; NEDAHM; small vasohibin-binding protein; coiled-coil domain containing 23; coiled-coil domain-containing protein 23 |
Gene ID | 374969 |
mRNA Refseq | NM_199342 |
Protein Refseq | NP_955374 |
MIM | 617853 |
UniProt ID | Q8N300 |
◆ Recombinant Proteins | ||
SVBP-2849HF | Recombinant Full Length Human SVBP Protein, GST-tagged | +Inquiry |
Svbp-6235M | Recombinant Mouse Svbp Protein, Myc/DDK-tagged | +Inquiry |
SVBP-2814H | Recombinant Human SVBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SVBP-0538H | Recombinant Human SVBP Protein, GST-Tagged | +Inquiry |
SVBP-3076H | Recombinant Human SVBP Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SVBP Products
Required fields are marked with *
My Review for All SVBP Products
Required fields are marked with *