Recombinant Full Length Human TCEA1 Protein
| Cat.No. : | TCEA1-519HF |
| Product Overview : | Recombinant full length Human TCEA1 with N terminal proprietary tag; Predicted MWt 59.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 301 amino acids |
| Description : | Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene. |
| Form : | Liquid |
| Molecular Mass : | 59.180kDa inclusive of tags |
| AA Sequence : | MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLEL LQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKD AKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS ADEPMTTFVVCNECGNRWKFC |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ] |
| Official Symbol | TCEA1 |
| Synonyms | TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS |
| Gene ID | 6917 |
| mRNA Refseq | NM_006756 |
| Protein Refseq | NP_006747 |
| MIM | 601425 |
| UniProt ID | P23193 |
| ◆ Recombinant Proteins | ||
| TCEA1-30067TH | Recombinant Human TCEA1 | +Inquiry |
| TCEA1-10356Z | Recombinant Zebrafish TCEA1 | +Inquiry |
| TCEA1-4645R | Recombinant Rhesus monkey TCEA1 Protein, His-tagged | +Inquiry |
| TCEA1-4461R | Recombinant Rhesus Macaque TCEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TCEA1-6769H | Recombinant Human Transcription Elongation Factor A (SII), 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TCEA1-442HKCL | Human TCEA1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEA1 Products
Required fields are marked with *
My Review for All TCEA1 Products
Required fields are marked with *
