Recombinant Full Length Human TIGIT Protein, C-Flag-tagged
Cat.No. : | TIGIT-235HFL |
Product Overview : | Recombinant Full Length Human TIGIT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens (human) ] |
Official Symbol | TIGIT |
Synonyms | VSIG9; VSTM3; WUCAM |
Gene ID | 201633 |
mRNA Refseq | NM_173799.4 |
Protein Refseq | NP_776160.2 |
MIM | 612859 |
UniProt ID | Q495A1 |
◆ Recombinant Proteins | ||
TIGIT-0802R | Active Recombinant Rat TIGIT protein(Met1-Ala138), hFc-tagged | +Inquiry |
TIGIT-0631H | Active Recombinant Human TIGIT protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
TIGIT-120C | Recombinant Cynomolgus/Rhesus macaque TIGIT protein, Fc-tagged | +Inquiry |
Tigit-149M | Recombinant Mouse Tigit Protein, His (Fc)-Avi-tagged | +Inquiry |
TIGIT-5739H | Active Recombinant Human TIGIT protein(Met1-Pro141), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIGIT Products
Required fields are marked with *
My Review for All TIGIT Products
Required fields are marked with *