Recombinant Human TIGIT Protein

• Cat.No.: TIGIT-23H
• Product Overview: Recombinant Human TIGIT Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
• Form: Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl.
• Molecular Mass: ~13 kDa
• AA Sequence: HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 2.0 mg/ml
• Official Full Name: T cell immunoreceptor with Ig and ITIM domains

Gene Information

• Gene Name: TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens (human) ]
• Official Symbol: TIGIT
• Synonyms: VSIG9; VSTM3; WUCAM
• Gene ID: 201633
• mRNA Refseq: NM_173799
• Protein Refseq: NP_776160
• MIM: 612859
• UniProt ID: Q495A1