Recombinant Human TIGIT Protein
Cat.No. : | TIGIT-23H |
Product Overview : | Recombinant Human TIGIT Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses. |
Form : | Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl. |
Molecular Mass : | ~13 kDa |
AA Sequence : | HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 2.0 mg/ml |
Official Full Name : | T cell immunoreceptor with Ig and ITIM domains |
Gene Name | TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens (human) ] |
Official Symbol | TIGIT |
Synonyms | VSIG9; VSTM3; WUCAM |
Gene ID | 201633 |
mRNA Refseq | NM_173799 |
Protein Refseq | NP_776160 |
MIM | 612859 |
UniProt ID | Q495A1 |
◆ Recombinant Proteins | ||
TIGIT-108H | Active Recombinant Human TIGIT protein, mFc-tagged | +Inquiry |
Tigit-109M | Active Recombinant Mouse Tigit protein, His-tagged | +Inquiry |
TIGIT-360H | Recombinant Human TIGIT protein, His-Avi-tagged, Biotinylated | +Inquiry |
Tigit-7407MAF488 | Recombinant Mouse Tigit Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TIGIT-235HFL | Recombinant Full Length Human TIGIT Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIGIT Products
Required fields are marked with *
My Review for All TIGIT Products
Required fields are marked with *
0
Inquiry Basket