Recombinant Full Length Human TXLNA Protein, C-Flag-tagged
Cat.No. : | TXLNA-303HFL |
Product Overview : | Recombinant Full Length Human TXLNA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRD VSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDP NTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKKYAELLEEHRNSQKQM KLLQKKQSQLVQEKDHLCGEHSKAVLARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVT LNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKE AEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSA GGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | TXLNA taxilin alpha [ Homo sapiens (human) ] |
Official Symbol | TXLNA |
Synonyms | IL14; TXLN |
Gene ID | 200081 |
mRNA Refseq | NM_175852.4 |
Protein Refseq | NP_787048.1 |
MIM | 608676 |
UniProt ID | P40222 |
◆ Recombinant Proteins | ||
TXLNA-5778H | Recombinant Human TXLNA protein, His & T7-tagged | +Inquiry |
TXLNA-2281H | Recombinant Human TXLNA Protein, His (Fc)-Avi-tagged | +Inquiry |
TXLNA-514H | Recombinant Human TXLNA Protein, His-tagged | +Inquiry |
TXLNA-27H | Recombinant Human TXLNA, His-tagged | +Inquiry |
TXLNA-4537H | Recombinant Human TXLNA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXLNA-629HCL | Recombinant Human TXLNA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXLNA Products
Required fields are marked with *
My Review for All TXLNA Products
Required fields are marked with *
0
Inquiry Basket