Recombinant Full Length Human TXLNGY Protein, GST-tagged
| Cat.No. : | TXLNGY-3877HF | 
| Product Overview : | Human CYorf15B full-length ORF ( AAH35312.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 114 amino acids | 
| Description : | TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. GO annotations related to this gene include syntaxin binding. | 
| Molecular Mass : | 39.9 kDa | 
| AA Sequence : | MNSHSSSFFFASFICRSVLLTYIILDNKEEHMQQKKEEEEVLKEVTAHFQITLTETQAQLEQHEIHNAKLQQENMEMGEKLKKLTDQYALREEVNGVWFVYRQLLTSSKSYTLP | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ] | 
| Official Symbol | TXLNGY | 
| Synonyms | CYorf15B; TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A | 
| Gene ID | 246126 | 
| MIM | 400031 | 
| UniProt ID | Q9BZA5 | 
| ◆ Recombinant Proteins | ||
| TXLNGY-3877HF | Recombinant Full Length Human TXLNGY Protein, GST-tagged | +Inquiry | 
| TXLNGY-5193H | Recombinant Human TXLNGY Protein, GST-tagged | +Inquiry | 
| TXLNGY-4455H | Recombinant Human TXLNGY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXLNGY Products
Required fields are marked with *
My Review for All TXLNGY Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            