Recombinant Full Length Human TXLNGY Protein, GST-tagged
Cat.No. : | TXLNGY-3877HF |
Product Overview : | Human CYorf15B full-length ORF ( AAH35312.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 114 amino acids |
Description : | TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. GO annotations related to this gene include syntaxin binding. |
Molecular Mass : | 39.9 kDa |
AA Sequence : | MNSHSSSFFFASFICRSVLLTYIILDNKEEHMQQKKEEEEVLKEVTAHFQITLTETQAQLEQHEIHNAKLQQENMEMGEKLKKLTDQYALREEVNGVWFVYRQLLTSSKSYTLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ] |
Official Symbol | TXLNGY |
Synonyms | CYorf15B; TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A |
Gene ID | 246126 |
MIM | 400031 |
UniProt ID | Q9BZA5 |
◆ Recombinant Proteins | ||
TXLNGY-5193H | Recombinant Human TXLNGY Protein, GST-tagged | +Inquiry |
TXLNGY-4455H | Recombinant Human TXLNGY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TXLNGY-3877HF | Recombinant Full Length Human TXLNGY Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXLNGY Products
Required fields are marked with *
My Review for All TXLNGY Products
Required fields are marked with *