Recombinant Human TXLNGY Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TXLNGY-4455H
Product Overview : CYorf15A MS Standard C13 and N15-labeled recombinant protein (NP_001005852) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. Gene Ontology (GO) annotations related to this gene include syntaxin binding.
Molecular Mass : 14.7 kDa
AA Sequence : MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLERQGLSLSPRLERGGTFMGHGSLKLPELVILSLQTLETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ]
Official Symbol TXLNGY
Synonyms TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A; CYorf15B; lipopolysaccaride-specific response 5-like protein; taxilin gamma 2, pseudogene; FLJ33216; MGC21662; MGC131732; DKFZp451G0616
Gene ID 246126
mRNA Refseq NM_001005852
Protein Refseq NP_001005852
MIM 400031

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXLNGY Products

Required fields are marked with *

My Review for All TXLNGY Products

Required fields are marked with *

0
cart-icon
0
compare icon