Recombinant Human TXLNGY Protein, GST-tagged

Cat.No. : TXLNGY-5193H
Product Overview : Human CYorf15B full-length ORF ( AAH35312.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. GO annotations related to this gene include syntaxin binding.
Molecular Mass : 39.9 kDa
AA Sequence : MNSHSSSFFFASFICRSVLLTYIILDNKEEHMQQKKEEEEVLKEVTAHFQITLTETQAQLEQHEIHNAKLQQENMEMGEKLKKLTDQYALREEVNGVWFVYRQLLTSSKSYTLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ]
Official Symbol TXLNGY
Synonyms CYorf15B; TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A
Gene ID 246126
MIM 400031
UniProt ID Q9BZA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXLNGY Products

Required fields are marked with *

My Review for All TXLNGY Products

Required fields are marked with *

0
cart-icon