Recombinant Full Length Human Uncharacterized Protein C12Orf69(C12Orf69) Protein, His-Tagged
| Cat.No. : | RFL33870HF |
| Product Overview : | Recombinant Full Length Human Uncharacterized protein C12orf69(C12orf69) Protein (A2RU48) (1-225aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-225) |
| Form : | Lyophilized powder |
| AA Sequence : | MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDG TIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVI LGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAIL GAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SMCO3 |
| Synonyms | SMCO3; C12orf69; Single-pass membrane and coiled-coil domain-containing protein 3 |
| UniProt ID | A2RU48 |
| ◆ Recombinant Proteins | ||
| Smco3-5965M | Recombinant Mouse Smco3 Protein, Myc/DDK-tagged | +Inquiry |
| SMCO3-1905H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged | +Inquiry |
| SMCO3-367H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SMCO3-1768HF | Recombinant Full Length Human SMCO3 Protein | +Inquiry |
| RFL33870HF | Recombinant Full Length Human Uncharacterized Protein C12Orf69(C12Orf69) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMCO3 Products
Required fields are marked with *
My Review for All SMCO3 Products
Required fields are marked with *
