Recombinant Full Length Human Vesicle-Associated Membrane Protein 2(Vamp2) Protein, His-Tagged
Cat.No. : | RFL16819HF |
Product Overview : | Recombinant Full Length Human Vesicle-associated membrane protein 2(VAMP2) Protein (P63027) (2-116aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-116) |
Form : | Lyophilized powder |
AA Sequence : | SATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VAMP2 |
Synonyms | FLJ11460; RATVAMPB; RATVAMPIR; SYB; SYB2; Synaptobrevin 2; Synaptobrevin-2; VAMP 2; VAMP-2; Vamp2; VAMP2_HUMAN; Vesicle associated membrane protein 2; Vesicle-associated membrane protein 2 (synaptobrevin 2); Vesicle-associated membrane protein 2 |
UniProt ID | P63027 |
◆ Recombinant Proteins | ||
VAMP2-6148R | Recombinant Rat VAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP2-544H | Recombinant Human VAMP2 Protein, His&GST-tagged | +Inquiry |
VAMP2-10366Z | Recombinant Zebrafish VAMP2 | +Inquiry |
VAMP2-2420R | Recombinant Rat VAMP2 Protein (2-94 aa), His-tagged | +Inquiry |
VAMP2-216H | Recombinant Human VAMP2 Protein, His Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP2-438HCL | Recombinant Human VAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP2 Products
Required fields are marked with *
My Review for All VAMP2 Products
Required fields are marked with *