Recombinant Human vesicle-associated membrane protein 2 (synaptobrevin 2) Protein, His tagged

Cat.No. : VAMP2-22H
Product Overview : Recombinant human VAMP2 protein, fused to His-tag at N-terminus, was expressed in E, coli and using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-94aa
Description : The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG.
Tag : N-His
Form : Liquid
Molecular Mass : 12.8 kDa
AA Sequence : MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol, 0.1mM PMSF
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
References : 1. Lin RC., et al. (1997) Neuron. 19(5):1087-94.
2. Hanson PI., et al. (1997) Cell. 90(3):523-35.
3. Scales SJ., et al. (2002) J Biol Chem. 277(31):28271-9.
4. Windoffer R., et al. (1999) Cell Tissue Res. 296(3):499-510.
Gene Name VAMP2 vesicle-associated membrane protein 2 (synaptobrevin 2) [ Homo sapiens (human) ]
Official Symbol VAMP2
Synonyms VAMP2; vesicle-associated membrane protein 2 (synaptobrevin 2); SYB2; vesicle-associated membrane protein 2; VAMP 2; synaptobrevin 2; synaptobrevin-2; vesicle associated membrane protein 2; VAMP-2; FLJ11460;
Gene ID 6844
mRNA Refseq NM_014232
Protein Refseq NP_055047
MIM 185881
UniProt ID P63027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VAMP2 Products

Required fields are marked with *

My Review for All VAMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon