Recombinant Full Length Human ZG16B Protein, C-Flag-tagged

• Cat.No.: ZG16B-1396HFL
• Product Overview: Recombinant Full Length Human ZG16B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable carbohydrate binding activity. Involved in retina homeostasis. Located in extracellular exosome.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 22.6 kDa
• AA Sequence: MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDY DHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKD RYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: ZG16B zymogen granule protein 16B [ Homo sapiens (human) ]
• Official Symbol: ZG16B
• Synonyms: EECP; PAUF; JCLN2; HRPE773; PRO1567
• Gene ID: 124220
• mRNA Refseq: NM_145252.3
• Protein Refseq: NP_660295.3
• UniProt ID: Q96DA0