Recombinant Full Length Human ZG16B Protein, C-Flag-tagged

Cat.No. : ZG16B-1396HFL
Product Overview : Recombinant Full Length Human ZG16B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable carbohydrate binding activity. Involved in retina homeostasis. Located in extracellular exosome.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 22.6 kDa
AA Sequence : MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDY DHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKD RYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name ZG16B zymogen granule protein 16B [ Homo sapiens (human) ]
Official Symbol ZG16B
Synonyms EECP; PAUF; JCLN2; HRPE773; PRO1567
Gene ID 124220
mRNA Refseq NM_145252.3
Protein Refseq NP_660295.3
UniProt ID Q96DA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZG16B Products

Required fields are marked with *

My Review for All ZG16B Products

Required fields are marked with *

0
cart-icon
0
compare icon