Recombinant Full Length Macaca Nemestrina Tumor Necrosis Factor Ligand Superfamily Member 6(Faslg) Protein, His-Tagged
Cat.No. : | RFL34796MF |
Product Overview : | Recombinant Full Length Macaca nemestrina Tumor necrosis factor ligand superfamily member 6(FASLG) Protein (P63306) (1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca nemestrina |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-280) |
Form : | Lyophilized powder |
AA Sequence : | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPSPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FASLG |
Synonyms | FASLG; CD95L; FASL; TNFSF6; Tumor necrosis factor ligand superfamily member 6; CD95 ligand; CD95-L; Fas antigen ligand; Fas ligand; FasL; CD antigen CD178 |
UniProt ID | P63306 |
◆ Recombinant Proteins | ||
RFL4270RF | Recombinant Full Length Rat Tumor Necrosis Factor Ligand Superfamily Member 6(Faslg) Protein, His-Tagged | +Inquiry |
FASLG-4861HF | Recombinant Full Length Human FASLG Protein, GST-tagged | +Inquiry |
FASLG-234H | Recombinant Human FASLG, C13&N15-labeled | +Inquiry |
FASLG-1469R | Recombinant Rhesus Macaque FASLG Protein, His (Fc)-Avi-tagged | +Inquiry |
FASLG-2274R | Recombinant Rat FASLG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *
0
Inquiry Basket