Recombinant Full Length Mouse Fms-Related Tyrosine Kinase 3 Ligand(Flt3Lg) Protein, His-Tagged
Cat.No. : | RFL35157MF |
Product Overview : | Recombinant Full Length Mouse Fms-related tyrosine kinase 3 ligand(Flt3lg) Protein (P49772) (27-232aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-232) |
Form : | Lyophilized powder |
AA Sequence : | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Flt3lg |
Synonyms | Flt3lg; Flt3l; Fms-related tyrosine kinase 3 ligand; Flt3 ligand; Flt3L; SL cytokine |
UniProt ID | P49772 |
◆ Recombinant Proteins | ||
FLT3LG-278H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, HIgG1 Fc-tagged | +Inquiry |
FLT3LG-04P | Active Recombinant Pig FLT3LG Protein (Ser30-Leu205), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FLT3LG-939H | Recombinant Human FLT3LG Protein, His-tagged | +Inquiry |
FLT3LG-2339H | Recombinant Human FLT3LG Protein, MYC/DDK-tagged | +Inquiry |
FLT3LG-11H | Active Recombinant Human FLT3LG Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Flt3lg Products
Required fields are marked with *
My Review for All Flt3lg Products
Required fields are marked with *