Recombinant Human FLT3LG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FLT3LG-3369H |
Product Overview : | FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 -positive classical DCs and their CD103 (ITGAE)-positive tissue counterparts. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens (human) ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
Gene ID | 2323 |
mRNA Refseq | NM_001459 |
Protein Refseq | NP_001450 |
MIM | 600007 |
UniProt ID | P49771 |
◆ Recombinant Proteins | ||
FLT3LG-719H | Active Recombinant Human FLT3LG Protein | +Inquiry |
FLT3LG-8532H | Recombinant Human FLT3LG protein(Thr27-Pro185), His-tagged | +Inquiry |
FLT3LG-8901H | Active Recombinant Human FLT3LG | +Inquiry |
FLT3LG-156H | Recombinant Human FLT3LG protein, C-His-tagged | +Inquiry |
FLT3LG-275H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, MIgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket