Recombinant Human FLT3LG Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FLT3LG-3369H
• Product Overview: FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 -positive classical DCs and their CD103 (ITGAE)-positive tissue counterparts.
• Molecular Mass: 26.4 kDa
• AA Sequence: MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens (human) ]
• Official Symbol: FLT3LG
• Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L
• Gene ID: 2323
• mRNA Refseq: NM_001459
• Protein Refseq: NP_001450
• MIM: 600007
• UniProt ID: P49771