Recombinant Human FLT3LG Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FLT3LG-3369H
Product Overview : FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 -positive classical DCs and their CD103 (ITGAE)-positive tissue counterparts.
Molecular Mass : 26.4 kDa
AA Sequence : MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens (human) ]
Official Symbol FLT3LG
Synonyms FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L;
Gene ID 2323
mRNA Refseq NM_001459
Protein Refseq NP_001450
MIM 600007
UniProt ID P49771

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT3LG Products

Required fields are marked with *

My Review for All FLT3LG Products

Required fields are marked with *

0
cart-icon
0
compare icon