Recombinant Full Length Mouse S100a4 Protein, His-tagged
Cat.No. : | S100a4-7323M |
Product Overview : | Recombinant mouse S100A4 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-101 |
Description : | Biased expression in bladder adult (RPKM 53.9), mammary gland adult (RPKM 13.8) and 10 other tissues. |
Form : | Liquid |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK |
Purity : | > 90 % |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 2 mM DTT, 0.1 M NaCl |
Gene Name | S100a4 S100 calcium binding protein A4 [ Mus musculus (house mouse) ] |
Official Symbol | S100a4 |
Synonyms | S100a4; S100 calcium binding protein A4; |
Gene ID | 20198 |
mRNA Refseq | NM_011311 |
Protein Refseq | NP_035441 |
UniProt ID | P07091 |
◆ Recombinant Proteins | ||
S100A4-2120C | Recombinant Cattle S100A4 protein, His-tagged | +Inquiry |
S100A4-4590H | Recombinant Human S100A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100a4-533M | Recombinant Mouse S100a4 protein, His-tagged | +Inquiry |
S100A4-89H | Recombinant Human S100A4 | +Inquiry |
S100A4-1051HFL | Recombinant Full Length Human S100A4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
S100A4-001MCL | Recombinant Mouse S100A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100a4 Products
Required fields are marked with *
My Review for All S100a4 Products
Required fields are marked with *
0
Inquiry Basket