Recombinant Full Length Mouse S100a4 Protein, His-tagged

• Cat.No.: S100a4-7323M
• Product Overview: Recombinant mouse S100A4 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-101
• Description: Biased expression in bladder adult (RPKM 53.9), mammary gland adult (RPKM 13.8) and 10 other tissues.
• Form: Liquid
• Molecular Mass: 13.9 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
• Purity: > 90 %
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 2 mM DTT, 0.1 M NaCl

Gene Information

• Gene Name: S100a4 S100 calcium binding protein A4 [ Mus musculus (house mouse) ]
• Official Symbol: S100a4
• Synonyms: S100a4; S100 calcium binding protein A4
• Gene ID: 20198
• mRNA Refseq: NM_011311
• Protein Refseq: NP_035441
• UniProt ID: P07091