Recombinant Full Length Mouse S100a4 Protein, His-tagged
| Cat.No. : | S100a4-7323M |
| Product Overview : | Recombinant mouse S100A4 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101 |
| Description : | Biased expression in bladder adult (RPKM 53.9), mammary gland adult (RPKM 13.8) and 10 other tissues. |
| Form : | Liquid |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK |
| Purity : | > 90 % |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 2 mM DTT, 0.1 M NaCl |
| Gene Name | S100a4 S100 calcium binding protein A4 [ Mus musculus (house mouse) ] |
| Official Symbol | S100a4 |
| Synonyms | S100a4; S100 calcium binding protein A4; |
| Gene ID | 20198 |
| mRNA Refseq | NM_011311 |
| Protein Refseq | NP_035441 |
| UniProt ID | P07091 |
| ◆ Recombinant Proteins | ||
| S100A4-31367TH | Recombinant Human S100A4 | +Inquiry |
| S100A4-4872R | Recombinant Rat S100A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| S100A4-1051HFL | Recombinant Full Length Human S100A4 Protein, C-Flag-tagged | +Inquiry |
| S100A4-409H | Recombinant Full Length Human S100 calcium binding protein A4 Protein, His tagged | +Inquiry |
| S100a4-3542M | Recombinant Mouse S100a4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
| S100A4-001MCL | Recombinant Mouse S100A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a4 Products
Required fields are marked with *
My Review for All S100a4 Products
Required fields are marked with *
