Recombinant Full Length Mouse S100a4 Protein, His-tagged

Cat.No. : S100a4-7323M
Product Overview : Recombinant mouse S100A4 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-101
Description : Biased expression in bladder adult (RPKM 53.9), mammary gland adult (RPKM 13.8) and 10 other tissues.
Form : Liquid
Molecular Mass : 13.9 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Purity : > 90 %
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 2 mM DTT, 0.1 M NaCl
Gene Name S100a4 S100 calcium binding protein A4 [ Mus musculus (house mouse) ]
Official Symbol S100a4
Synonyms S100a4; S100 calcium binding protein A4;
Gene ID 20198
mRNA Refseq NM_011311
Protein Refseq NP_035441
UniProt ID P07091

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a4 Products

Required fields are marked with *

My Review for All S100a4 Products

Required fields are marked with *

0
cart-icon
0
compare icon