Recombinant Full Length Mouse SAA1 Protein
Cat.No. : | SAA1-71M |
Product Overview : | Recombinant Mouse SAA1 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 21-122 a.a. |
Description : | This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. |
Form : | Supplied as a 0.2 μm filtered solution in 50 mM Tris-HCl, 300 mM NaCl (pH 8.0). |
Molecular Mass : | ~12 kDa |
AA Sequence : | GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.1 mg/ml |
Official Full Name : | Serum amyloid A1 |
Gene Name | SAA1 serum amyloid A1 [ Homo sapiens (human) ] |
Official Symbol | SAA1 |
Synonyms | SAA; PIG4; SAA2; TP53I4 |
Gene ID | 6288 |
mRNA Refseq | NM_000331 |
Protein Refseq | NP_000322 |
MIM | 104750 |
UniProt ID | P0DJI8 |
◆ Recombinant Proteins | ||
SAA1-73HFL | Recombinant Full Length Human SAA1 Protein, C-Flag-tagged | +Inquiry |
SAA1-31166TH | Recombinant Human SAA1, His-tagged | +Inquiry |
SAA1-5110H | Recombinant Human Serum Amyloid A1, His-tagged | +Inquiry |
SAA1-1052H | Recombinant Human SAA Protein | +Inquiry |
SAA1-3463H | Recombinant Human SAA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket