Active Recombinant Human SAA1 protein

Cat.No. : SAA1-2668H
Product Overview : Recombinant Human SAA1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 19-122 a.a.
Description : Serum amyloid A protein which belongs to the SAA family is encoded by the SAA gene in humans. It is expressed by the liver and secreted in plasma. Serum amyloid A is the major acute phase reactant and apolipoprotein of the HDL complex. Elevated serum SAA protein levels may be associated with lung cancer. The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL Apo-lipoprotein. Recombinant human Apo-SAA1 is an 11.7 kDa protein containing 104 amino acid residues.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 9.0, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
AA Sequence : RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name SAA1
Official Symbol SAA1
Synonyms SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4; tumor protein p53 inducible protein 4; SAA2; MGC111216;
Gene ID 6288
mRNA Refseq NM_000331
Protein Refseq NP_000322
MIM 104750
UniProt ID P0DJI8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAA1 Products

Required fields are marked with *

My Review for All SAA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon