Active Recombinant Human SAA1 protein
Cat.No. : | SAA1-2668H |
Product Overview : | Recombinant Human SAA1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 19-122 a.a. |
Description : | Serum amyloid A protein which belongs to the SAA family is encoded by the SAA gene in humans. It is expressed by the liver and secreted in plasma. Serum amyloid A is the major acute phase reactant and apolipoprotein of the HDL complex. Elevated serum SAA protein levels may be associated with lung cancer. The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL Apo-lipoprotein. Recombinant human Apo-SAA1 is an 11.7 kDa protein containing 104 amino acid residues. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 9.0, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human monocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. |
AA Sequence : | RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SAA1 |
Official Symbol | SAA1 |
Synonyms | SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4; tumor protein p53 inducible protein 4; SAA2; MGC111216; |
Gene ID | 6288 |
mRNA Refseq | NM_000331 |
Protein Refseq | NP_000322 |
MIM | 104750 |
UniProt ID | P0DJI8 |
◆ Recombinant Proteins | ||
SAA1-1364D | Recombinant Dog SAA1 Protein, His-GST-tagged | +Inquiry |
SAA1-3467B | Recombinant Bovine SAA1 protein, His-SUMO & Myc-tagged | +Inquiry |
SAA1-1403H | Recombinant Human Serum Amyloid A1 | +Inquiry |
SAA1-31166TH | Recombinant Human SAA1, His-tagged | +Inquiry |
SAA1-31162TH | Recombinant Human SAA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket