Recombinant Full Length Mouse T-Lymphocyte Activation Antigen Cd86(Cd86) Protein, His-Tagged
| Cat.No. : | RFL31563MF |
| Product Overview : | Recombinant Full Length Mouse T-lymphocyte activation antigen CD86(Cd86) Protein (P42082) (24-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (24-309) |
| Form : | Lyophilized powder |
| AA Sequence : | VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd86 |
| Synonyms | Cd86; T-lymphocyte activation antigen CD86; Activation B7-2 antigen; Early T-cell costimulatory molecule 1; ETC-1; CD antigen CD86 |
| UniProt ID | P42082 |
| ◆ Recombinant Proteins | ||
| CD86-578R | Recombinant Rhesus Macaque CD86 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cd86-5625M | Recombinant Mouse Cd86 Protein (Val24-Lys244), C-His tagged | +Inquiry |
| CD86-704H | Recombinant Human CD86 Protein, His-tagged | +Inquiry |
| CD86-585H | Active Recombinant Human CD86 Protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
| CD86-253H | Recombinant Human CD86 Protein, DYKDDDDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD86-2598MCL | Recombinant Mouse CD86 cell lysate | +Inquiry |
| CD86-2619HCL | Recombinant Human CD86 cell lysate | +Inquiry |
| CD86-1013CCL | Recombinant Cynomolgus CD86 cell lysate | +Inquiry |
| CD86-1971RCL | Recombinant Rat CD86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd86 Products
Required fields are marked with *
My Review for All Cd86 Products
Required fields are marked with *
