Recombinant Full Length Pan Troglodytes Cd81 Antigen(Cd81) Protein, His-Tagged
Cat.No. : | RFL9503PF |
Product Overview : | Recombinant Full Length Pan troglodytes CD81 antigen(CD81) Protein (P60034) (1-236aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-236) |
Form : | Lyophilized powder |
AA Sequence : | MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSN IISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD81 |
Synonyms | CD81; TAPA1; CD81 antigen; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; CD antigen CD81 |
UniProt ID | P60034 |
◆ Recombinant Proteins | ||
CD81-576R | Recombinant Rhesus Macaque CD81 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD81-0268H | Recombinant Human CD81 protein, mFc-tagged | +Inquiry |
CD81-2225C | Recombinant Chicken CD81 | +Inquiry |
CD81-400M | Recombinant Mouse CD81 Protein (116-201 aa), GST-tagged | +Inquiry |
CD81-0866H | Recombinant Human CD81 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *