Recombinant Full Length Pan Troglodytes Natural Cytotoxicity Triggering Receptor 3(Ncr3) Protein, His-Tagged
Cat.No. : | RFL12024PF |
Product Overview : | Recombinant Full Length Pan troglodytes Natural cytotoxicity triggering receptor 3(NCR3) Protein (P61484) (19-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-201) |
Form : | Lyophilized powder |
AA Sequence : | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNETPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAQLLPPVPGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NCR3 |
Synonyms | NCR3; Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein; NK-p30; NKp30; CD antigen CD337 |
UniProt ID | P61484 |
◆ Recombinant Proteins | ||
NCR3-2780R | Recombinant Rhesus Macaque NCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCR3-4179H | Recombinant Human NCR3 Protein (Leu19-Thr138), C-His tagged | +Inquiry |
NCR3-399H | Recombinant Human NCR3 Protein, Fc-tagged | +Inquiry |
NCR3-498C | Active Recombinant Cynomolgus NCR3 Protein, His-tagged | +Inquiry |
NCR3-582H | Recombinant Human NCR3 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCR3-2652HCL | Recombinant Human NCR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR3 Products
Required fields are marked with *
My Review for All NCR3 Products
Required fields are marked with *
0
Inquiry Basket