Recombinant Full Length Pig Cytochrome B5(Cyb5A) Protein, His-Tagged
Cat.No. : | RFL30016SF |
Product Overview : | Recombinant Full Length Pig Cytochrome b5(CYB5A) Protein (P00172) (2-134aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-134) |
Form : | Lyophilized powder |
AA Sequence : | AEQSDKAVKYYTLEEIQKHNNSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTFIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISAL VVSLMYHFYTSEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYB5A |
Synonyms | CYB5A; CYB5; Cytochrome b5 |
UniProt ID | P00172 |
◆ Recombinant Proteins | ||
CYB5A-001H | Recombinant Human CYB5A Protein, His-tagged | +Inquiry |
RFL23898OF | Recombinant Full Length Rabbit Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
RFL16619HF | Recombinant Full Length Human Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
RFL9499EF | Recombinant Full Length Horse Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
CYB5A-12352Z | Recombinant Zebrafish CYB5A | +Inquiry |
◆ Native Proteins | ||
CYB5A-30H | Recombinant Human CYB5A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *
0
Inquiry Basket