Recombinant Human CYB5A Protein, His-tagged
Cat.No. : | CYB5A-001H |
Product Overview : | Recombinant human CYB5A protein(1-108aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 1-108 a.a. |
Description : | CYB5A, also known as cytochrome b5 isoform 1, is a member of membrane-bound cytochrome b5 family. It reduces ferric hemoglobin to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. This protein acts as an electron carrier for several membrane bound oxygenases. |
Form : | Liquid |
Molecular Mass : | 13.3 kDa |
N-terminal Sequence Analysis : | Ala |
Endotoxin : | < 1.0 EU per 1 μg of protein (determined by LAL method) |
Purity : | > 90% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1.0 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
AA Sequence : | ADPMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSHHHHHH |
Gene Name | CYB5A cytochrome b5 type A [ Homo sapiens (human) ] |
Official Symbol | CYB5A |
Synonyms | CYB5A; cytochrome b5 type A; CYB5; MCB5; METAG; cytochrome b5; cytochrome b5 type A (microsomal); epididymis secretory sperm binding protein; type 1 cyt-b5 |
Gene ID | 1528 |
mRNA Refseq | NM_148923 |
Protein Refseq | NP_683725 |
MIM | 613218 |
UniProt ID | P00167 |
◆ Recombinant Proteins | ||
CYB5A-1700R | Recombinant Rat CYB5A Protein | +Inquiry |
RFL16619HF | Recombinant Full Length Human Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
CYB5A-12352Z | Recombinant Zebrafish CYB5A | +Inquiry |
CYB5A-947R | Recombinant Rhesus Macaque CYB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
Cyb5a-427M | Recombinant Mouse Cyb5a Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CYB5A-30H | Recombinant Human CYB5A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *