Recombinant Human CYB5A Protein, His-tagged

Cat.No. : CYB5A-001H
Product Overview : Recombinant human CYB5A protein(1-108aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability January 16, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 1-108 a.a.
Description : CYB5A, also known as cytochrome b5 isoform 1, is a member of membrane-bound cytochrome b5 family. It reduces ferric hemoglobin to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. This protein acts as an electron carrier for several membrane bound oxygenases.
Form : Liquid
Molecular Mass : 13.3 kDa
N-terminal Sequence Analysis : Ala
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : ADPMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSHHHHHH
Gene Name CYB5A cytochrome b5 type A [ Homo sapiens (human) ]
Official Symbol CYB5A
Synonyms CYB5A; cytochrome b5 type A; CYB5; MCB5; METAG; cytochrome b5; cytochrome b5 type A (microsomal); epididymis secretory sperm binding protein; type 1 cyt-b5
Gene ID 1528
mRNA Refseq NM_148923
Protein Refseq NP_683725
MIM 613218
UniProt ID P00167

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB5A Products

Required fields are marked with *

My Review for All CYB5A Products

Required fields are marked with *

0
cart-icon
0
compare icon