Recombinant Human CYB5A Protein, His-tagged
| Cat.No. : | CYB5A-001H |
| Product Overview : | Recombinant human CYB5A protein(1-108aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 1-108 a.a. |
| Description : | CYB5A, also known as cytochrome b5 isoform 1, is a member of membrane-bound cytochrome b5 family. It reduces ferric hemoglobin to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. This protein acts as an electron carrier for several membrane bound oxygenases. |
| Form : | Liquid |
| Molecular Mass : | 13.3 kDa |
| N-terminal Sequence Analysis : | Ala |
| Endotoxin : | < 1.0 EU per 1 μg of protein (determined by LAL method) |
| Purity : | > 90% by SDS - PAGE |
| Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1.0 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
| Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
| AA Sequence : | ADPMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSHHHHHH |
| Gene Name | CYB5A cytochrome b5 type A [ Homo sapiens (human) ] |
| Official Symbol | CYB5A |
| Synonyms | CYB5A; cytochrome b5 type A; CYB5; MCB5; METAG; cytochrome b5; cytochrome b5 type A (microsomal); epididymis secretory sperm binding protein; type 1 cyt-b5 |
| Gene ID | 1528 |
| mRNA Refseq | NM_148923 |
| Protein Refseq | NP_683725 |
| MIM | 613218 |
| UniProt ID | P00167 |
| ◆ Recombinant Proteins | ||
| CYB5A-27555TH | Recombinant Human CYB5A, His-tagged | +Inquiry |
| RFL27014RF | Recombinant Full Length Rat Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
| CYB5A-1662HFL | Recombinant Full Length Human CYB5A Protein, C-Flag-tagged | +Inquiry |
| RFL23898OF | Recombinant Full Length Rabbit Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
| CYB5A-001H | Recombinant Human CYB5A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *
