Recombinant Human CYB5A Protein, His-tagged

• Cat.No.: CYB5A-001H
• Product Overview: Recombinant human CYB5A protein(1-108aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 1-108 a.a.
• Description: CYB5A, also known as cytochrome b5 isoform 1, is a member of membrane-bound cytochrome b5 family. It reduces ferric hemoglobin to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. This protein acts as an electron carrier for several membrane bound oxygenases.
• Form: Liquid
• Molecular Mass: 13.3 kDa
• N-terminal Sequence Analysis: Ala
• Endotoxin: < 1.0 EU per 1 μg of protein (determined by LAL method)
• Purity: > 90% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1.0 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
• Warning: For research use only. This product is not intended or approved for human, diagnostics or veterin
• AA Sequence: ADPMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSHHHHHH

Gene Information

• Gene Name: CYB5A cytochrome b5 type A [ Homo sapiens (human) ]
• Official Symbol: CYB5A
• Synonyms: CYB5A; cytochrome b5 type A; CYB5; MCB5; METAG; cytochrome b5; cytochrome b5 type A (microsomal); epididymis secretory sperm binding protein; type 1 cyt-b5
• Gene ID: 1528
• mRNA Refseq: NM_148923
• Protein Refseq: NP_683725
• MIM: 613218
• UniProt ID: P00167