Recombinant Full Length Pig Growth Hormone Receptor(Ghr) Protein, His-Tagged
Cat.No. : | RFL6297SF |
Product Overview : | Recombinant Full Length Pig Growth hormone receptor(GHR) Protein (P19756) (19-638aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-638) |
Form : | Lyophilized powder |
AA Sequence : | FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFRFPWFLIIIFGIFGLTVILFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYSDDSWVEFIELDIDDPDEKTEGSDTDRLLNNDHEKSLTILGAKEDDSGRTSCYEPDILETDFNANDVCDGTAEVAQPQRLKGEADLLCLDQKNQNNSPSNDAAPATQQPSVILAEENKPRPLIISGTDSTHQTAHTQLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGISQCDMHLEVVSPCPANFIMDNAYFCEADAKKCIAMAPHVEVESRLAPSFNQEDIYITTESLTTTAGRSATAECAPSSEMPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GHR |
Synonyms | GHR; Growth hormone receptor; GH receptor; Somatotropin receptor |
UniProt ID | P19756 |
◆ Recombinant Proteins | ||
RFL32525HF | Recombinant Full Length Human Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
GHR-1053R | Recombinant Rabbit GHR protein, His&Myc-tagged | +Inquiry |
RFL13600BF | Recombinant Full Length Bovine Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
GHR-1505R | Active Recombinant Rhesus macaque GHR protein, Fc-tagged | +Inquiry |
GHR-39H | Recombinant Human GHR protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *
0
Inquiry Basket