Recombinant Full Length Pig Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged
Cat.No. : | RFL3278SF |
Product Overview : | Recombinant Full Length Pig Melatonin receptor type 1A(MTNR1A) Protein (O02781) (1-154aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-154) |
Form : | Lyophilized powder |
AA Sequence : | YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTNR1A |
Synonyms | MTNR1A; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor; Fragment |
UniProt ID | O02781 |
◆ Recombinant Proteins | ||
MTNR1A-30196TH | Recombinant Human MTNR1A | +Inquiry |
Mtnr1a-8165M | Recombinant Mouse Mtnr1a protein, His-tagged | +Inquiry |
MTNR1A-301234H | Recombinant Human MTNR1A protein, GST-tagged | +Inquiry |
RFL21682PF | Recombinant Full Length Phodopus Sungorus Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged | +Inquiry |
MTNR1A-1455H | Recombinant Human MTNR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTNR1A-4071HCL | Recombinant Human MTNR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTNR1A Products
Required fields are marked with *
My Review for All MTNR1A Products
Required fields are marked with *