Recombinant Full Length Pig Metalloreductase Steap1(Steap1) Protein, His-Tagged
Cat.No. : | RFL9628SF |
Product Overview : | Recombinant Full Length Pig Metalloreductase STEAP1(STEAP1) Protein (Q9GL50) (1-338aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-338) |
Form : | Lyophilized powder |
AA Sequence : | MESRQDITNQEELWKMKPRKNLEDDYLNEDSRENSMPKRPMLVHLHQTAHFDEFDCPPEL QHKQELFPKWHLPIKIAAIVSSLTFLYTLLREVIHPFVTSHQQYFYKIPILVINKVLPMV SITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDRWMVTRKQFGLLSFFFAVLHAVYSLS YPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVTLAILALLAVTSIPSV SDSLTWREFHYIQSTLGIVSLLLGTIHALIFAWNKWVDIKQFIWYTPPTFMIAVFLPTVV LICKVILLLPCLRRKILKIRHGWEDVTKINKTEMSSQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STEAP1 |
Synonyms | STEAP1; STEAP; Metalloreductase STEAP1; Six transmembrane endothelial antigen of PAEC; Six-transmembrane epithelial antigen of prostate 1 |
UniProt ID | Q9GL50 |
◆ Recombinant Proteins | ||
STEAP1-399HFL | Recombinant Full Length Human STEAP1 Protein, C-Flag-tagged | +Inquiry |
STEAP1-2899H | Recombinant Human STEAP1 Protein, MYC/DDK-tagged | +Inquiry |
STEAP1-3000H | Recombinant Human STEAP1 protein, His-tagged | +Inquiry |
STEAP1-2120H | Recombinant Human STEAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STEAP1-3928H | Recombinant Human STEAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STEAP1 Products
Required fields are marked with *
My Review for All STEAP1 Products
Required fields are marked with *
0
Inquiry Basket