Recombinant Full Length Rabbit D(1A) Dopamine Receptor(Drd1) Protein, His-Tagged
Cat.No. : | RFL28566OF |
Product Overview : | Recombinant Full Length Rabbit D(1A) dopamine receptor(DRD1) Protein (O02664) (1-180aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-180) |
Form : | Lyophilized powder |
AA Sequence : | NTLLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIW VAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILIGVAWTLSVLISFIPV QLSWHKAKPTSPPDGNATSLDETVDNCDSSLSRTYSISSSLVNFYNPVAIMXVTYTRIHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DRD1 |
Synonyms | DRD1; D(1A dopamine receptor; Dopamine D1 receptor; Fragment |
UniProt ID | O02664 |
◆ Recombinant Proteins | ||
DRD1-1098HFL | Recombinant Human DRD1 protein, His&Flag-tagged | +Inquiry |
RFL8615XF | Recombinant Full Length Xenopus Laevis D(1A) Dopamine Receptor Protein, His-Tagged | +Inquiry |
RFL24292HF | Recombinant Full Length Human D(1A) Dopamine Receptor(Drd1) Protein, His-Tagged | +Inquiry |
DRD1-3904C | Recombinant Chicken DRD1 | +Inquiry |
RFL17407SF | Recombinant Full Length Pig D(1A) Dopamine Receptor(Drd1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD1-20HL | Recombinant Human DRD1 HEK293T cell lysate | +Inquiry |
DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRD1 Products
Required fields are marked with *
My Review for All DRD1 Products
Required fields are marked with *
0
Inquiry Basket