Recombinant Full Length Rat Alpha-2A Adrenergic Receptor(Adra2A) Protein, His-Tagged
Cat.No. : | RFL-7159RF |
Product Overview : | Recombinant Full Length Rat Alpha-2A adrenergic receptor(Adra2a) Protein (P22909) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Adra2a |
Synonyms | Adra2a; Alpha-2A adrenergic receptor; Alpha-2A adrenoreceptor; Alpha-2A adrenoceptor; Alpha-2AAR; Alpha-2D adrenergic receptor; CA2-47 |
UniProt ID | P22909 |
◆ Recombinant Proteins | ||
ADRA2A-3331P | Recombinant Pig ADRA2A, His-tagged | +Inquiry |
ADRA2A-1937H | Recombinant Human ADRA2A Full Length Transmembrane protein, His-tagged | +Inquiry |
ADRA2A-9442H | Recombinant Human ADRA2A, GST-tagged | +Inquiry |
ADRA2A-379H | Recombinant Human ADRA2A Protein | +Inquiry |
RFL14920DF | Recombinant Full Length Danio Rerio Alpha-2A Adrenergic Receptor(Adra2A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRA2A-9000HCL | Recombinant Human ADRA2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Adra2a Products
Required fields are marked with *
My Review for All Adra2a Products
Required fields are marked with *
0
Inquiry Basket