Recombinant Full Length Rat apolipoprotein E Protein, His tagged

• Cat.No.: APOE-726R
• Product Overview: Recombinant Full Length Rat apolipoprotein E Protein (1-312 aa) with His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 1-312 aa
• Description: Enables several functions, including amyloid-beta binding activity; hydroxyapatite binding activity; and phospholipid binding activity. Involved in several processes, including cellular response to alcohol; neurogenesis; and regulation of lipid metabolic process. Located in several cellular components, including endosome; microtubule; and neuronal cell body. Is extrinsic component of external side of plasma membrane. Part of several cellular components, including discoidal high-density lipoprotein particle; low-density lipoprotein particle; and triglyceride-rich plasma lipoprotein particle. Used to study artery disease (multiple); familial hyperlipidemia (multiple); glomerulosclerosis; middle cerebral artery infarction; and steatotic liver disease (multiple). Biomarker of several diseases, including glomerulonephritis (multiple); hyperhomocysteinemia; hypertension; sciatic neuropathy; and transient cerebral ischemia. Human ortholog(s) of this gene implicated in several diseases, including Alzheimer''s disease (multiple); artery disease (multiple); biliary tract cancer (multiple); eye disease (multiple); and familial hyperlipidemia (multiple). Orthologous to human APOE (apolipoprotein E).
• Molecular Mass: 34 kDa
• AA Sequence: EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: Apoe apolipoprotein E [ Rattus norvegicus (Norway rat) ]
• Official Symbol: APOE
• Synonyms: APOE; apolipoprotein E; apo-E; APOEA
• Gene ID: 25728
• mRNA Refseq: NM_138828
• Protein Refseq: NP_620183
• UniProt ID: P02650