Recombinant Full Length Rat apolipoprotein E Protein, His tagged
| Cat.No. : | APOE-726R |
| Product Overview : | Recombinant Full Length Rat apolipoprotein E Protein (1-312 aa) with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-312 aa |
| Description : | Enables several functions, including amyloid-beta binding activity; hydroxyapatite binding activity; and phospholipid binding activity. Involved in several processes, including cellular response to alcohol; neurogenesis; and regulation of lipid metabolic process. Located in several cellular components, including endosome; microtubule; and neuronal cell body. Is extrinsic component of external side of plasma membrane. Part of several cellular components, including discoidal high-density lipoprotein particle; low-density lipoprotein particle; and triglyceride-rich plasma lipoprotein particle. Used to study artery disease (multiple); familial hyperlipidemia (multiple); glomerulosclerosis; middle cerebral artery infarction; and steatotic liver disease (multiple). Biomarker of several diseases, including glomerulonephritis (multiple); hyperhomocysteinemia; hypertension; sciatic neuropathy; and transient cerebral ischemia. Human ortholog(s) of this gene implicated in several diseases, including Alzheimer''s disease (multiple); artery disease (multiple); biliary tract cancer (multiple); eye disease (multiple); and familial hyperlipidemia (multiple). Orthologous to human APOE (apolipoprotein E). |
| Molecular Mass : | 34 kDa |
| AA Sequence : | EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | Apoe apolipoprotein E [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | APOE |
| Synonyms | APOE; apolipoprotein E; apo-E; APOEA; |
| Gene ID | 25728 |
| mRNA Refseq | NM_138828 |
| Protein Refseq | NP_620183 |
| UniProt ID | P02650 |
| ◆ Recombinant Proteins | ||
| APOE4-2869HB | Recombinant Human APOE4 protein, His-Trx-tagged, Amine-Labeled Biotinylated | +Inquiry |
| APOE-694H | Recombinant Human Apolipoprotein E, E4 Isoform | +Inquiry |
| APOE-0635H | Recombinant Human APOE Protein (Lys19-His317), His-tagged | +Inquiry |
| APOE-088H | Active Recombinant Human APOE Protein, Myc/DDK-tagged | +Inquiry |
| APOE-17HAF555 | Recombinant Human APOE Protein, His-tagged, Alexa 555 Conjugated | +Inquiry |
| ◆ Native Proteins | ||
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| ApoE-3560H | Native Human ApoE | +Inquiry |
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
