Recombinant Mouse Apoe protein, His&Myc-tagged
| Cat.No. : | Apoe-2199M |
| Product Overview : | Recombinant Mouse Apoe protein(P08226)(19-311aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 19-311aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.9 kDa |
| AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Apoe apolipoprotein E [ Mus musculus ] |
| Official Symbol | Apoe |
| Synonyms | APOE; apolipoprotein E; apo-E; AI255918; |
| Gene ID | 11816 |
| mRNA Refseq | NM_009696 |
| Protein Refseq | NP_033826 |
| ◆ Recombinant Proteins | ||
| APOE4-2872H | Active Recombinant Human APOE4 protein(C130R), His-tagged | +Inquiry |
| APOE-1377H | Active Recombinant Human APOE Protein, His-tagged | +Inquiry |
| Apoe-543R | Recombinant Rat Apoe protein, His-tagged | +Inquiry |
| APOE4-2868H | Recombinant Human APOE4 protein, hFc-tagged | +Inquiry |
| APOE-4562R | Recombinant Rhesus macaque APOE protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| ApoE-3560H | Native Human ApoE | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *
