Recombinant Mouse Apoe protein, His&Myc-tagged
Cat.No. : | Apoe-2199M |
Product Overview : | Recombinant Mouse Apoe protein(P08226)(19-311aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 19-311aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.9 kDa |
AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Apoe apolipoprotein E [ Mus musculus ] |
Official Symbol | Apoe |
Synonyms | APOE; apolipoprotein E; apo-E; AI255918; |
Gene ID | 11816 |
mRNA Refseq | NM_009696 |
Protein Refseq | NP_033826 |
◆ Recombinant Proteins | ||
APOE-226C | Recombinant Cattle APOE Protein, His-tagged | +Inquiry |
APOE-382R | Recombinant Rat APOE Protein, His (Fc)-Avi-tagged | +Inquiry |
APOE-17HAF555 | Recombinant Human APOE Protein, His-tagged, Alexa 555 Conjugated | +Inquiry |
APOE-0636H | Recombinant Human APOE Protein (Lys19-His317), C-His-tagged | +Inquiry |
Apoe-1129M | Recombinant Mouse Aope Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *
0
Inquiry Basket