Recombinant Full Length Rat Carbohydrate Sulfotransferase 11(Chst11) Protein, His-Tagged
Cat.No. : | RFL2433RF |
Product Overview : | Recombinant Full Length Rat Carbohydrate sulfotransferase 11(Chst11) Protein (P69478) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAILHQMRRDQVTDTCRANSAMSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLSGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIRRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLRLAGVSGYLKFPTYAKSTRTTDEMTTEFFQNISAEHQTQLYEVYKLDFLMFNYSVPNYLKLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Chst11 |
Synonyms | Chst11; Carbohydrate sulfotransferase 11; Chondroitin 4-O-sulfotransferase 1; Chondroitin 4-sulfotransferase 1; C4S-1; C4ST-1; C4ST1 |
UniProt ID | P69478 |
◆ Recombinant Proteins | ||
CHST11-148H | Recombinant Human CHST11 protein, His-tagged | +Inquiry |
CHST11-301460H | Recombinant Human CHST11 protein, GST-tagged | +Inquiry |
RFL2433RF | Recombinant Full Length Rat Carbohydrate Sulfotransferase 11(Chst11) Protein, His-Tagged | +Inquiry |
CHST11-11224H | Recombinant Human CHST11, His-tagged | +Inquiry |
CHST11-867R | Recombinant Rhesus monkey CHST11 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST11-001HCL | Recombinant Human CHST11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Chst11 Products
Required fields are marked with *
My Review for All Chst11 Products
Required fields are marked with *
0
Inquiry Basket