Recombinant Full Length Rat Chemokine-Like Receptor 1(Cmklr1) Protein, His-Tagged
Cat.No. : | RFL13564RF |
Product Overview : | Recombinant Full Length Rat Chemokine-like receptor 1(Cmklr1) Protein (O35786) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MEYEGYNDSSIYGEEYSDGSDYIVDLEEAGPLEAKVAEVFLVVIYSLVCFLGILGNGLVI VIATFKMKKTVNTVWFVNLAVADFLFNIFLPIHITYAAMDYHWVFGKAMCKISSFLLSHN MYTSVFLLTVISFDRCISVLLPVWSQNHRSVRLAYMTCVVVWVWLSSESPPSLVFGHVST SHGKITCFNNFSLAAPEPFSHSTHPRTDPVGYSRHVAVTVTRFLCGFLIPVFIITACYLT IVFKLQRNRQAKTKKPFKIIITIIITFFLCWCPYHTLYLLELHHTAVPASVFSLGLPLAT AVAIANSCMNPILYVFMGHDFKKFKVALFSRLVNALSEDTGPSSYPSHRSFTKMSSLIEK ASVNEKETSTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cmklr1 |
Synonyms | Cmklr1; Dez; Chemerin-like receptor 1; Chemokine-like receptor 1; G-protein coupled chemoattractant-like receptor; G-protein coupled receptor DEZ |
UniProt ID | O35786 |
◆ Recombinant Proteins | ||
RFL13564RF | Recombinant Full Length Rat Chemokine-Like Receptor 1(Cmklr1) Protein, His-Tagged | +Inquiry |
CMKLR1-1782M | Recombinant Mouse CMKLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMKLR1-0234H | Recombinant Human CMKLR1 Full Length Transmembrane protein, Flag-tagged(Nanodisc) | +Inquiry |
CMKLR1-1539H | Recombinant Human CMKLR1 Protein, GST-tagged | +Inquiry |
CMKLR1-1904HF | Recombinant Full Length Human CMKLR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMKLR1-189HCL | Recombinant Human CMKLR1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cmklr1 Products
Required fields are marked with *
My Review for All Cmklr1 Products
Required fields are marked with *