Recombinant Human CMKLR1 protein, His-GST&Myc-tagged
| Cat.No. : | CMKLR1-4633H |
| Product Overview : | Recombinant Human CMKLR1 protein(Q99788)(321-373aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 321-373aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |
| Gene Name | CMKLR1 chemokine-like receptor 1 [ Homo sapiens ] |
| Official Symbol | CMKLR1 |
| Synonyms | CMKLR1; chemokine-like receptor 1; chemokine receptor-like 1; G-protein coupled receptor DEZ; G-protein coupled receptor ChemR23; orphan G-protein coupled receptor, Dez; DEZ; ChemR23; CHEMERINR; MGC126105; MGC126106; |
| Gene ID | 1240 |
| mRNA Refseq | NM_001142343 |
| Protein Refseq | NP_001135815 |
| MIM | 602351 |
| UniProt ID | Q99788 |
| ◆ Recombinant Proteins | ||
| CMKLR1-7854H | Recombinant Human CMKLR1 protein, His-tagged | +Inquiry |
| CMKLR1-4633H | Recombinant Human CMKLR1 protein, His-GST&Myc-tagged | +Inquiry |
| CMKLR1-3624M | Recombinant Mouse CMKLR1 Protein | +Inquiry |
| RFL13564RF | Recombinant Full Length Rat Chemokine-Like Receptor 1(Cmklr1) Protein, His-Tagged | +Inquiry |
| CMKLR1-5220Z | Recombinant Zebrafish CMKLR1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CMKLR1-189HCL | Recombinant Human CMKLR1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMKLR1 Products
Required fields are marked with *
My Review for All CMKLR1 Products
Required fields are marked with *



