Recombinant Human CMKLR1 protein, His-GST&Myc-tagged
Cat.No. : | CMKLR1-4633H |
Product Overview : | Recombinant Human CMKLR1 protein(Q99788)(321-373aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 321-373aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |
Gene Name | CMKLR1 chemokine-like receptor 1 [ Homo sapiens ] |
Official Symbol | CMKLR1 |
Synonyms | CMKLR1; chemokine-like receptor 1; chemokine receptor-like 1; G-protein coupled receptor DEZ; G-protein coupled receptor ChemR23; orphan G-protein coupled receptor, Dez; DEZ; ChemR23; CHEMERINR; MGC126105; MGC126106; |
Gene ID | 1240 |
mRNA Refseq | NM_001142343 |
Protein Refseq | NP_001135815 |
MIM | 602351 |
UniProt ID | Q99788 |
◆ Recombinant Proteins | ||
CMKLR1-4633H | Recombinant Human CMKLR1 protein, His-GST&Myc-tagged | +Inquiry |
RFL19980HF | Recombinant Full Length Human Chemokine-Like Receptor 1(Cmklr1) Protein, His-Tagged | +Inquiry |
Cmklr1-1039M | Recombinant Mouse Cmklr1 Full Length Transmembrane protein, His-tagged | +Inquiry |
CMKLR1-20H | Recombinant Human CMKLR1 protein, hFc-tagged | +Inquiry |
CMKLR1-1904HF | Recombinant Full Length Human CMKLR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMKLR1-189HCL | Recombinant Human CMKLR1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMKLR1 Products
Required fields are marked with *
My Review for All CMKLR1 Products
Required fields are marked with *
0
Inquiry Basket