Recombinant Full Length Rat Gamma-Secretase Subunit Pen-2(Psenen) Protein, His-Tagged
| Cat.No. : | RFL17837RF |
| Product Overview : | Recombinant Full Length Rat Gamma-secretase subunit PEN-2(Psenen) Protein (Q6QI68) (1-101aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-101) |
| Form : | Lyophilized powder |
| AA Sequence : | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Psenen |
| Synonyms | Psenen; Gamma-secretase subunit PEN-2; Liver regeneration-related protein LRRGT00140; Presenilin enhancer protein 2 |
| UniProt ID | Q6QI68 |
| ◆ Recombinant Proteins | ||
| PSENEN-2005H | Recombinant Human PSENEN, GST-tagged | +Inquiry |
| PSENEN-7202M | Recombinant Mouse PSENEN Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSENEN-2467H | Recombinant Human PSENEN Full Length Transmembrane protein, His-tagged | +Inquiry |
| Psenen-5172M | Recombinant Mouse Psenen Protein, Myc/DDK-tagged | +Inquiry |
| PSENEN-3463R | Recombinant Rhesus Macaque PSENEN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSENEN-2789HCL | Recombinant Human PSENEN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Psenen Products
Required fields are marked with *
My Review for All Psenen Products
Required fields are marked with *
