Recombinant Full Length Rat Nadph Oxidase 4(Nox4) Protein, His-Tagged
Cat.No. : | RFL16211RF |
Product Overview : | Recombinant Full Length Rat NADPH oxidase 4(Nox4) Protein (Q924V1) (210-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (210-424) |
Form : | Lyophilized powder |
AA Sequence : | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKI CLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKE NFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPS SQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nox4 |
Synonyms | Nox4; Kox; NADPH oxidase 4; EC 1.6.3.-; Kidney oxidase-1; KOX-1; Kidney superoxide-producing NADPH oxidase |
UniProt ID | Q924V1 |
◆ Recombinant Proteins | ||
NOX4-1336H | Recombinant Human NOX4, GST-tagged | +Inquiry |
NOX4-2200R | Recombinant Rat NOX4 Protein (210-424 aa), His-B2M-tagged | +Inquiry |
NOX4-3282H | Recombinant Human NOX4 protein, His-tagged | +Inquiry |
NOX4-6008H | Recombinant Human NOX4 Protein, GST-tagged | +Inquiry |
NOX4-298H | Recombinant Human NOX4 protein, His-tagged(VLPs) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nox4 Products
Required fields are marked with *
My Review for All Nox4 Products
Required fields are marked with *
0
Inquiry Basket