Recombinant Human NOX4 protein, His-tagged(VLPs)
| Cat.No. : | NOX4-298H |
| Product Overview : | Recombinant Human NOX4 protein(Q9NPH5)(1-578aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-578aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| AA Sequence : | GGLLKYQTNVDTHPPGCISLNQTSSQNMSIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKI CLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKE NFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPS SQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYE |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | NOX4 NADPH oxidase 4 [ Homo sapiens ] |
| Official Symbol | NOX4 |
| Synonyms | NOX4; NADPH oxidase 4; KOX; KOX 1; kidney oxidase-1; renal NAD(P)H-oxidase; kidney superoxide-producing NADPH oxidase; KOX-1; RENOX; |
| Gene ID | 50507 |
| mRNA Refseq | NM_001143836 |
| Protein Refseq | NP_001137308 |
| MIM | 605261 |
| UniProt ID | Q9NPH5 |
| ◆ Recombinant Proteins | ||
| NOX4-3740C | Recombinant Chicken NOX4 | +Inquiry |
| RFL35916PF | Recombinant Full Length Pongo Abelii Nadph Oxidase 4(Nox4) Protein, His-Tagged | +Inquiry |
| NOX4-2948H | Recombinant Human NOX4 Transmembrane protein, His-tagged | +Inquiry |
| RFL28341HF | Recombinant Full Length Human Nadph Oxidase 4(Nox4) Protein, His-Tagged | +Inquiry |
| NOX4-1977H | Recombinant Human NOX4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *
