Recombinant Human NOX4 protein, His-tagged(VLPs)
Cat.No. : | NOX4-298H |
Product Overview : | Recombinant Human NOX4 protein(Q9NPH5)(1-578aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-578aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
AA Sequence : | GGLLKYQTNVDTHPPGCISLNQTSSQNMSIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKI CLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKE NFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPS SQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYE |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | NOX4 NADPH oxidase 4 [ Homo sapiens ] |
Official Symbol | NOX4 |
Synonyms | NOX4; NADPH oxidase 4; KOX; KOX 1; kidney oxidase-1; renal NAD(P)H-oxidase; kidney superoxide-producing NADPH oxidase; KOX-1; RENOX; |
Gene ID | 50507 |
mRNA Refseq | NM_001143836 |
Protein Refseq | NP_001137308 |
MIM | 605261 |
UniProt ID | Q9NPH5 |
◆ Recombinant Proteins | ||
Nox4-1840M | Recombinant Mouse Nox4 Protein, His-tagged | +Inquiry |
NOX4-2200R | Recombinant Rat NOX4 Protein (210-424 aa), His-B2M-tagged | +Inquiry |
NOX4-29711TH | Recombinant Human NOX4 | +Inquiry |
NOX4-2783H | Recombinant Human NOX4 Protein (Gly210-Glu424), His tagged | +Inquiry |
NOX4-3691R | Recombinant Rat NOX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *
0
Inquiry Basket