Recombinant Human NOX4 protein, His-tagged(VLPs)

Cat.No. : NOX4-298H
Product Overview : Recombinant Human NOX4 protein(Q9NPH5)(1-578aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-578aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence : GGLLKYQTNVDTHPPGCISLNQTSSQNMSIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKI CLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKE NFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPS SQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYE
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name NOX4 NADPH oxidase 4 [ Homo sapiens ]
Official Symbol NOX4
Synonyms NOX4; NADPH oxidase 4; KOX; KOX 1; kidney oxidase-1; renal NAD(P)H-oxidase; kidney superoxide-producing NADPH oxidase; KOX-1; RENOX;
Gene ID 50507
mRNA Refseq NM_001143836
Protein Refseq NP_001137308
MIM 605261
UniProt ID Q9NPH5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOX4 Products

Required fields are marked with *

My Review for All NOX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon