Recombinant Full Length Rat T-Cell Surface Glycoprotein Cd8 Beta Chain(Cd8B) Protein, His-Tagged
| Cat.No. : | RFL10801RF |
| Product Overview : | Recombinant Full Length Rat T-cell surface glycoprotein CD8 beta chain(Cd8b) Protein (P05541) (22-208aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-208) |
| Form : | Lyophilized powder |
| AA Sequence : | LLQTPSSLLVQTNQTAKMSCEAKTFPKGTTIYWLRELQDSNKNKHFEFLASRTSTKGIKYGERVKKNMTLSFNSTLPFLKIMDVKPEDSGFYFCAMVGSPMVVFGTGTKLTVVDVLPTTAPTKKTTLKKKQCPTPHPKTQKGLTCGLITLSLLVACILVLLVSLSVAIHFHCMRRRARIHFMKQFHK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd8b |
| Synonyms | Cd8b; Cd8b1; T-cell surface glycoprotein CD8 beta chain; CD8 antigen 37 kDa chain; OX-8 membrane antigen; CD antigen CD8b |
| UniProt ID | P05541 |
| ◆ Recombinant Proteins | ||
| CD8B-253H | Recombinant Human CD8B | +Inquiry |
| CD8B-270H | Recombinant Human CD8B Protein, Fc-tagged | +Inquiry |
| CD8B-3754H | Recombinant Human CD8B protein, rFc-tagged | +Inquiry |
| CD8B-5306H | Recombinant Human CD8B Protein (Met1-Pro170), C-His tagged | +Inquiry |
| CD8B-0880H | Recombinant Human CD8B Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd8b Products
Required fields are marked with *
My Review for All Cd8b Products
Required fields are marked with *
