Recombinant Full Length Saccharomyces Cerevisiae Iron Transporter Fth1(Fth1) Protein, His-Tagged
Cat.No. : | RFL17141SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Iron transporter FTH1(FTH1) Protein (P38310) (1-465aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-465) |
Form : | Lyophilized powder |
AA Sequence : | MAFEDYFSFQIFFIFLRESLEIVVIVSILLTIVKQGLSVEDDSPFEGSSSSAGLPSPNTN TNADSTTAFLQAGPSDGNAIGTSATAANNKSRPLNVEEEEEIYEYSNELRDQDRESDEHT ADNVKLYQKLKIQILAGGAFGLLLCMLIGGAFVSIFYHIGTDLWTLSEHYYEGVLSLVAS VIISVMGLFFLRMGKLREKFRVKLASIIYSKDNNLLGNKTQKGVKFSEKYSFFILPFITT LREGLEAVVFIGGIGIDQPLSSIPLSMVLATAISTVFGIFFFRYSSSLSLKICLVVATCF LYLIAAGLFSKGVWQLELQDYVNKCNGQDMSEVGNGPGSYDISRSVWHVNCCNGEKDGGW MIFTAIFGWTNSATVGSVISYNAYWLVLICALKLLMIEEKYGYIPYLPISWQKKRIMKRL SIAKASLDLKHHTSELNSSTSEPDSQRRSKDSSVPLIIDSSGSAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FTH1 |
Synonyms | FTH1; YBR207W; YBR1446; Iron transporter FTH1 |
UniProt ID | P38310 |
◆ Recombinant Proteins | ||
FTH1-8239S | Recombinant Sheep FTH1 protein, His-tagged | +Inquiry |
FTH1-528H-PE | Recombinant Human FTH1 Protein, R-PE labeled | +Inquiry |
FTH1-3038H | Recombinant Human FTH1 Protein (Met1-Ser183), N-His tagged | +Inquiry |
FTH1-3039H | Recombinant Human FTH1 Protein (Ala814-Arg1036), N-His tagged | +Inquiry |
FTH1-5121HF | Recombinant Full Length Human FTH1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FTH1-28155TH | Native Human FTH1 | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
FTH1-001H | Native Horse FTH1 Protein | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTH1-6128HCL | Recombinant Human FTH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTH1 Products
Required fields are marked with *
My Review for All FTH1 Products
Required fields are marked with *