Recombinant Full Length Schizosaccharomyces Pombe Cytochrome C Oxidase Assembly Protein Cox16, Mitochondrial(Cox16) Protein, His-Tagged
| Cat.No. : | RFL17761SF |
| Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16) Protein (Q9UTK1) (13-113aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Schizosaccharomyces pombe |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (13-113) |
| Form : | Lyophilized powder |
| AA Sequence : | QAKKSPFIYVGLPFLSSVLLVWSCLIPISQVKFNRRDEQVKSLSRDAELDIIKRRRKVDV NEEYYRILLDQLNLQNEEYENKRVKRLKGEPTWEGNSSDKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | cox16 |
| Synonyms | cox16; SPAC1486.08; Cytochrome c oxidase assembly protein cox16, mitochondrial |
| UniProt ID | Q9UTK1 |
| ◆ Recombinant Proteins | ||
| RFL17761SF | Recombinant Full Length Schizosaccharomyces Pombe Cytochrome C Oxidase Assembly Protein Cox16, Mitochondrial(Cox16) Protein, His-Tagged | +Inquiry |
| COX16-2723H | Recombinant Human COX16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COX16-1737H | Recombinant Human COX16 Protein, GST-tagged | +Inquiry |
| COX16-1411H | Recombinant Human COX16 | +Inquiry |
| COX16-1998HF | Recombinant Full Length Human COX16 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX16-7336HCL | Recombinant Human COX16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cox16 Products
Required fields are marked with *
My Review for All cox16 Products
Required fields are marked with *



