Recombinant Full Length Vibrio Cholerae Serotype O1 Accessory Cholera Enterotoxin(Ace) Protein, His-Tagged
| Cat.No. : | RFL2350VF |
| Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Accessory cholera enterotoxin(ace) Protein (P38441) (1-96aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Vibrio cholerae serotype O1 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-96) |
| Form : | Lyophilized powder |
| AA Sequence : | MLMMDTLYDWLIDGFTWLVIKLGIMWIESKIFVIQFFWEMSQKVIDMFTIYPLIQQAIDM LPPQYSGFLFFLGLDQALAIVLQALMTRFALRALNL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ace |
| Synonyms | ace; VC_1459; Accessory cholera enterotoxin; Ace |
| UniProt ID | P38441 |
| ◆ Recombinant Proteins | ||
| ACE-1570R | Recombinant Rhesus Monkey ACE Protein | +Inquiry |
| Ace-512M | Recombinant Mouse Ace protein, His & MBP-tagged | +Inquiry |
| ACE-509H | Recombinant Human ACE protein, His & GST-tagged | +Inquiry |
| Ace-511M | Recombinant Mouse Ace protein, His & GST-tagged | +Inquiry |
| Ace-513M | Recombinant Mouse Ace protein, His & S-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ACE-3047R | Native rabbit ACE | +Inquiry |
| ACE-02R | Active Recombinant Rabbit Angiotensin Converting Enzyme | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACE-9094HCL | Recombinant Human ACE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ace Products
Required fields are marked with *
My Review for All ace Products
Required fields are marked with *
