Recombinant Full Length Xenopus Tropicalis Frizzled-7(Fzd7) Protein, His-Tagged
Cat.No. : | RFL33853XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Frizzled-7(fzd7) Protein (Q5BL72) (20-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-548) |
Form : | Lyophilized powder |
AA Sequence : | QQYHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKV QCSPELRFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP VHGAGEICVGQNTSDNSPSGPTARPTPYLPDSITFHPHPNRDFTCPRQLKVPPYLGYRFL GEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCGISTLFTVLTYLVDMRRFSYP ERPIIFLSGCYFMVAVAYTAGFLLEERGVCVERFSEDSYRTVAQGTKKEGCTILFMILYF FGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGD ILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLE KLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSP DFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRLSNGGKGETAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fzd7 |
Synonyms | fzd7; TNeu065e03.1; Frizzled-7; Frz7; Fz-7 |
UniProt ID | Q5BL72 |
◆ Recombinant Proteins | ||
FZD7-1113HFL | Recombinant Human FZD7 protein, His&Flag-tagged | +Inquiry |
FZD7-384H | Active Recombinant Human FZD7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
FZD7-4598H | Recombinant Human FZD7 Protein, GST-tagged | +Inquiry |
FZD7-537H | Active Recombinant Human FZD7 Protein, Fc-tagged | +Inquiry |
Fzd7-589M | Active Recombinant Mouse Frizzled Homolog 7 (Drosophila), Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fzd7 Products
Required fields are marked with *
My Review for All fzd7 Products
Required fields are marked with *
0
Inquiry Basket