Recombinant HBsAg
Cat.No. : | HBsAg-270H |
Product Overview : | The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HBV |
Source : | E.coli |
Tag : | Non |
Description : | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1. |
Form : | HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl. |
Molecular Mass : | 12.6 kDa |
AA Sequence : | MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLL GWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA. |
Purity : | HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Applications : | 1. Immunochromatography (capture and conjugate).2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1.3. ELISA. |
Storage : | This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
◆ Recombinant Proteins | ||
HBsAg-254H | Recombinant HBV HBsAg protein | +Inquiry |
HBsAg-233H | Recombinant HBV HBsAg protein, His-tagged | +Inquiry |
HBsAg-262H | Recombinant HBsAg | +Inquiry |
HBsAg-261H | Recombinant HBsAg | +Inquiry |
HBsAg-258H | Active Recombinant HBsAg | +Inquiry |
◆ Native Proteins | ||
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
HBsAg-321H | Active Native Hepatitis B Surface Ag Subtype Ad Protein | +Inquiry |
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All HBsAg Products
Required fields are marked with *
My Review for All HBsAg Products
Required fields are marked with *
0
Inquiry Basket