Recombinant Human AADAT Protein, GST-tagged
Cat.No. : | AADAT-016H |
Product Overview : | Human AADAT partial ORF ( NP_057312, 326 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | YSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AADAT aminoadipate aminotransferase [ Homo sapiens ] |
Official Symbol | AADAT |
Synonyms | AADAT; aminoadipate aminotransferase; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; KAT2; KATII; kynurenine aminotransferase II; L kynurenine/alpha aminoadipate aminotransferase; KAT/AadAT; 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; alpha-aminoadipate aminotransferase; kynurenine--oxoglutarate transaminase II; kynurenine--oxoglutarate aminotransferase II; |
Gene ID | 51166 |
mRNA Refseq | NM_016228 |
Protein Refseq | NP_057312 |
MIM | 611754 |
UniProt ID | Q8N5Z0 |
◆ Recombinant Proteins | ||
AADAT-570HFL | Active Recombinant Full Length Human AADAT Protein, C-Flag-tagged | +Inquiry |
AADAT-749HF | Recombinant Full Length Human AADAT Protein, GST-tagged | +Inquiry |
AADAT-4693H | Recombinant Human AADAT protein, His-SUMO-tagged | +Inquiry |
AADAT-015H | Recombinant Human AADAT Protein, GST-tagged | +Inquiry |
AADAT-1032H | Recombinant Human AADAT protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AADAT-9158HCL | Recombinant Human AADAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADAT Products
Required fields are marked with *
My Review for All AADAT Products
Required fields are marked with *