Recombinant Human ABCA2 Protein, GST-tagged
Cat.No. : | ABCA2-032H |
Product Overview : | Human ABCA2 partial ORF ( NP_001597, 76 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCA2 ATP-binding cassette, sub-family A (ABC1), member 2 [ Homo sapiens ] |
Official Symbol | ABCA2 |
Synonyms | ABCA2; ATP-binding cassette, sub-family A (ABC1), member 2; ABC2; ATP-binding cassette sub-family A member 2; ATP-binding cassette 2; ATP-binding cassette transporter 2; ATP-binding cassette, sub-family A, member 2; MGC129761; |
Gene ID | 20 |
mRNA Refseq | NM_001606 |
Protein Refseq | NP_001597 |
MIM | 600047 |
UniProt ID | Q9BZC7 |
◆ Recombinant Proteins | ||
Abca2-12M | Recombinant Mouse Abca2 protein, His-tagged | +Inquiry |
Abca2-3729M | Recombinant Mouse Abca2, His-tagged | +Inquiry |
ABCA2-48R | Recombinant Rat ABCA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCA2-032H | Recombinant Human ABCA2 Protein, GST-tagged | +Inquiry |
ABCA2-13H | Recombinant Human ABCA2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCA2 Products
Required fields are marked with *
My Review for All ABCA2 Products
Required fields are marked with *