Recombinant Human ABCA2 Protein, GST-tagged

Cat.No. : ABCA2-032H
Product Overview : Human ABCA2 partial ORF ( NP_001597, 76 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : PDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCA2 ATP-binding cassette, sub-family A (ABC1), member 2 [ Homo sapiens ]
Official Symbol ABCA2
Synonyms ABCA2; ATP-binding cassette, sub-family A (ABC1), member 2; ABC2; ATP-binding cassette sub-family A member 2; ATP-binding cassette 2; ATP-binding cassette transporter 2; ATP-binding cassette, sub-family A, member 2; MGC129761;
Gene ID 20
mRNA Refseq NM_001606
Protein Refseq NP_001597
MIM 600047
UniProt ID Q9BZC7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCA2 Products

Required fields are marked with *

My Review for All ABCA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon